Chlorotoxin

  • Chemical Properties
CAS No. 163515-35-3 Cat. No. BCP30217
Name Chlorotoxin
Synonyms
Formula C158H249N53O47S11 M. Wt 3995.7
  • Biological Activity
Description Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker. Sequence: Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2 (Disulfide bridge: Cys2-Cys19,Cys5-Cys28,Cys16-Cys33,Cys20-Cys35);MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: Cys2-Cys19,Cys5-Cys28,Cys16-Cys33,Cys20-Cys35).
Pathways Ion Channel/Membrane Transporter 
Targets Chloride Channel 

Structure

Part data of this page collected from the open network resources, so Biochempartner can not guarantee its accuracy.
For product details of different batches, please contact our Customer
Service & Tech Support:orders@biochempartner.com
Website:www.biochempartner.com
Products are for research use only and not for human use. We do not sell to patients.