Home   >  
Ion Channel/Membrane Transporter
  >  
Chloride Channel
  >   Chlorotoxin
Chlorotoxin Chemical Structure

Chlorotoxin

Data Sheet For research use only. Not for human use.
Cat. No. :BCP30217CAS No. :163515-35-3Purity:98%
Size Price Stock Quotation Inquiry
5.00 mg Get quote In-stock Quotation Inquiry
10.00 mg Get quote In-stock Quotation Inquiry
 Tel: 0086-17754423994   or   orders@biochempartner.com
Real-Time Inquiry ×

* Required Fields.

Please complete the form below and you will get the price list in 1 minute.

Product name

 

* Applicant name

Catalog Number

 

* Institution/Company

* Email address

 

Phone number

Country

 

* Quantity Required

Remarks

Inquiry Online ×

* Required Fields.

Please complete the form below and we will contact you shortly.

Product name

 

* Applicant name

Catalog Number

 

* Institution/Company

* Email address

 

Phone number

Country

 

* Quantity Required

Remarks

Bulk Inquiry ×

* Required Fields.

Please complete the form below and we will contact you shortly.

Product name

 

* Applicant name

Catalog Number

 

* Institution/Company

* Email address

 

Phone number

Country

 

* Quantity Required

Remarks

  • Chemical Properties&Biological Activity
CAS No. 163515-35-3 Cat. No. BCP30217
Name Chlorotoxin
Synonyms
SMILES
Chemical Name
Formula C158H249N53O47S11 M. Wt 3995.7
Purity 98% Storage Store at 4-8°C
Description Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker. Sequence: Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2 (Disulfide bridge: Cys2-Cys19,Cys5-Cys28,Cys16-Cys33,Cys20-Cys35);MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: Cys2-Cys19,Cys5-Cys28,Cys16-Cys33,Cys20-Cys35).
  • Quality Control&Technical Support
In the process of purchasing and using Biochempartner products, you can consult us if you have any problems: orders@biochempartner.com. We will try our best to solve all your doubts.

Recommend Products

More >

Tags:Chlorotoxin supplier,Chlorotoxin purchase,Chlorotoxin manufacturer,Chlorotoxin distributor,Chlorotoxin cost,Chlorotoxin buy,Chlorotoxin for sale

0086-13720134139